RNF186 antibody (70R-6682)

Rabbit polyclonal RNF186 antibody raised against the N terminal of RNF186

Synonyms Polyclonal RNF186 antibody, Anti-RNF186 antibody, RNF-186 antibody, Ring Finger Protein 186 antibody, FLJ20225 antibody, RNF-186, RNF 186, RNF 186 antibody, RNF186, RP11-91K11.1 antibody
Specificity RNF186 antibody was raised against the N terminal of RNF186
Cross Reactivity Human
Applications WB
Immunogen RNF186 antibody was raised using the N terminal of RNF186 corresponding to a region with amino acids MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP
Assay Information RNF186 Blocking Peptide, catalog no. 33R-5617, is also available for use as a blocking control in assays to test for specificity of this RNF186 antibody

Images

Western Blot analysis using RNF186 antibody (70R-6682)

RNF186 antibody (70R-6682) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNF186 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of RNF186 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNF186 antibody (70R-6682) | RNF186 antibody (70R-6682) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors