RNF19A antibody (70R-6263)

Rabbit polyclonal RNF19A antibody raised against the N terminal of RNF19A

Synonyms Polyclonal RNF19A antibody, Anti-RNF19A antibody, Ring Finger Protein 19A antibody, RNF19, DKFZp566B1346 antibody, DORFIN antibody, RNF 19, RNF-19, RNF 19 antibody, RNF19 antibody, RNF-19 antibody
Specificity RNF19A antibody was raised against the N terminal of RNF19A
Cross Reactivity Human,Mouse
Applications WB
Immunogen RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD
Assay Information RNF19A Blocking Peptide, catalog no. 33R-3962, is also available for use as a blocking control in assays to test for specificity of this RNF19A antibody

Images

Western Blot analysis using RNF19A antibody (70R-6263)

RNF19A antibody (70R-6263) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNF19A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNF19A contains two RING-finger motifs and an IBR (in between RING fingers) motif. This protein is an E3 ubiquintin ligase that is localized in Lewy bodies (LBs), a characteristic neuronal inclusion in Parkinson's disease (PD) brains. This protein interacts with UBE2L3/UBCH7 and UBE2E2/UBCH8, but not other ubiquitin-conjugating enzymes. This protein is found to bind and ubiquitylate synphilin 1 (SNCAIP), which is a interacting protein of alpha synuclein in neurons, and a major component of LB.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNF19A antibody (70R-6263) | RNF19A antibody (70R-6263) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors