RNF32 Blocking Peptide (33R-1073)

A synthetic peptide for use as a blocking control in assays to test for specificity of RNF32 antibody, catalog no. 70R-1166

Synonyms RNF32 control peptide, RNF32 antibody Blocking Peptide, Anti-RNF32 Blocking Peptide, Ring Finger Protein 32 Blocking Peptide, tcag7.575 Blocking Peptide, FKSG33 Blocking Peptide, HSD15 Blocking Peptide, RNF32, RNF-32, RNF 32, RNF-32 Blocking Peptide, RNF 32 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGC
Molecular Weight 40 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNF32 contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. Its gene was found to be expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors