RNF38 antibody (70R-1061)

Rabbit polyclonal RNF38 antibody raised against the N terminal of RNF38

Synonyms Polyclonal RNF38 antibody, Anti-RNF38 antibody, RNF-38 antibody, FLJ21343 antibody, RNF 38 antibody, RNF38, RNF-38, RNF 38, Ring Finger Protein 38 antibody
Specificity RNF38 antibody was raised against the N terminal of RNF38
Cross Reactivity Human
Applications WB
Immunogen RNF38 antibody was raised using the N terminal of RNF38 corresponding to a region with amino acids FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP
Assay Information RNF38 Blocking Peptide, catalog no. 33R-2874, is also available for use as a blocking control in assays to test for specificity of this RNF38 antibody

Images

Western Blot analysis using RNF38 antibody (70R-1061)

RNF38 antibody (70R-1061) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RNF38 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNF38 is a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNF38 antibody (70R-1061) | RNF38 antibody (70R-1061) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors