RNMT antibody (70R-4827)

Rabbit polyclonal RNMT antibody

Synonyms Polyclonal RNMT antibody, Anti-RNMT antibody, MET antibody, KIAA0398 antibody, hCMT1c antibody, RNA guanine 7 methyltransferase antibody , RG7MT1 antibody, DKFZp686H1252 antibody
Cross Reactivity Human
Applications WB
Immunogen RNMT antibody was raised using a synthetic peptide corresponding to a region with amino acids ETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQ
Assay Information RNMT Blocking Peptide, catalog no. 33R-2757, is also available for use as a blocking control in assays to test for specificity of this RNMT antibody


Western Blot analysis using RNMT antibody (70R-4827)

RNMT antibody (70R-4827) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNMT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNMT belongs to the mRNA cap methyltransferase family. RNMT is a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. It binds RNA containing 5'-terminal GpppC.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RNMT antibody (70R-4827) | RNMT antibody (70R-4827) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors