RNPC3 antibody (70R-4642)

Rabbit polyclonal RNPC3 antibody

Synonyms Polyclonal RNPC3 antibody, Anti-RNPC3 antibody, FLJ20008 antibody, KIAA183 antibody, RNA-Binding Region antibody, Rnp1 Rrm Containing 3 antibody, FLJ25070 antibody, RNPC-3 antibody, RBM40 antibody, RNPC 3 antibody, RNP antibody, RNPC-3, RNPC3, RNPC 3
Cross Reactivity Human
Applications WB
Immunogen RNPC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHAPLPPTSPQPPEEPPLPDEDEELSSEESEYESTDDEDRQRMNKLMELA
Assay Information RNPC3 Blocking Peptide, catalog no. 33R-5006, is also available for use as a blocking control in assays to test for specificity of this RNPC3 antibody


Western Blot analysis using RNPC3 antibody (70R-4642)

RNPC3 antibody (70R-4642) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNPC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNPC3 is an RNA-binding protein involved in pre-mRNA splicing. RNPC3 participates in pre-mRNA U12-dependent splicing. RNPC3 binds to the 3'-stem-loop of m7G-capped U12 snRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RNPC3 antibody (70R-4642) | RNPC3 antibody (70R-4642) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors