ROM1 antibody (70R-6107)

Rabbit polyclonal ROM1 antibody raised against the middle region of ROM1

Synonyms Polyclonal ROM1 antibody, Anti-ROM1 antibody, Retinal Outer Segment Membrane Protein 1 antibody, ROM-1, ROM-1 antibody, TSPAN23 antibody, ROM 1, ROM1, ROSP1 antibody, ROM 1 antibody, ROM antibody
Specificity ROM1 antibody was raised against the middle region of ROM1
Cross Reactivity Human
Applications WB
Immunogen ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT
Assay Information ROM1 Blocking Peptide, catalog no. 33R-6819, is also available for use as a blocking control in assays to test for specificity of this ROM1 antibody

Images

Western Blot analysis using ROM1 antibody (70R-6107)

ROM1 antibody (70R-6107) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ROM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ROM1 is an integral membrane protein found in the photoreceptor disk rim of the eye. It can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ROM1 antibody (70R-6107) | ROM1 antibody (70R-6107) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors