ROPN1B antibody (70R-3274)

Rabbit polyclonal ROPN1B antibody raised against the N terminal of ROPN1B

Synonyms Polyclonal ROPN1B antibody, Anti-ROPN1B antibody, ROPNB 1 antibody, ROPNB-1 antibody, Ropporin Rhophilin Associated Protein 1B antibody, ROPN1B, ROPNB-1, ROPNB 1
Specificity ROPN1B antibody was raised against the N terminal of ROPN1B
Cross Reactivity Human
Applications WB
Immunogen ROPN1B antibody was raised using the N terminal of ROPN1B corresponding to a region with amino acids DYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAE
Assay Information ROPN1B Blocking Peptide, catalog no. 33R-2236, is also available for use as a blocking control in assays to test for specificity of this ROPN1B antibody

Images

Western Blot analysis using ROPN1B antibody (70R-3274)

ROPN1B antibody (70R-3274) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ROPN1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ROPN1B belongs to the ropporin family and contains 1 RIIa domain. ROPN1B interacts with RHPN1 and AKAP3. It may interact with SPA17.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ROPN1B antibody (70R-3274) | ROPN1B antibody (70R-3274) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors