RP11-217H1.1 antibody (70R-7508)

Rabbit polyclonal RP11-217H1.1 antibody raised against the N terminal Of Rp11-217H1.1

Synonyms Polyclonal RP11-217H1.1 antibody, Anti-RP11-217H1.1 antibody, MGC64926 antibody, bA217H1.1 antibody, RP-217H1.1-11 antibody, RP-217H1.1-11, PRO0756 antibody, RP11-217H1.1, RP-217H1.1 11 antibody, MAGT1 antibody, RP-217H1.1 11, FLJ14726 antibody, DKFZp564K142 antibody
Specificity RP11-217H1.1 antibody was raised against the N terminal Of Rp11-217H1.1
Cross Reactivity Human
Applications WB
Immunogen RP11-217H1.1 antibody was raised using the N terminal Of Rp11-217H1.1 corresponding to a region with amino acids ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP
Assay Information RP11-217H1.1 Blocking Peptide, catalog no. 33R-1500, is also available for use as a blocking control in assays to test for specificity of this RP11-217H1.1 antibody

Images

Western Blot analysis using RP11-217H1.1 antibody (70R-7508)

RP11-217H1.1 antibody (70R-7508) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RP11-217H1.1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RP11-217H1.1 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RP11-217H1.1 antibody (70R-7508) | RP11-217H1.1 antibody (70R-7508) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors