RP11-269F19.9 antibody (70R-3967)

Rabbit polyclonal RP11-269F19.9 antibody raised against the middle region of RP11-269F19.9

Synonyms Polyclonal RP11-269F19.9 antibody, Anti-RP11-269F19.9 antibody, LOC343521 antibody, RP-269F19.9 11 antibody, RP11-269F19.9, RP-269F19.9-11, Tctex1 Domain Containing 4 antibody, RP-269F19.9 11, RP-269F19.9-11 antibody
Specificity RP11-269F19.9 antibody was raised against the middle region of RP11-269F19.9
Cross Reactivity Human
Applications WB
Immunogen RP11-269F19.9 antibody was raised using the middle region of RP11-269F19.9 corresponding to a region with amino acids VCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYC
Assay Information RP11-269F19.9 Blocking Peptide, catalog no. 33R-9454, is also available for use as a blocking control in assays to test for specificity of this RP11-269F19.9 antibody


Western Blot analysis using RP11-269F19.9 antibody (70R-3967)

RP11-269F19.9 antibody (70R-3967) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RP11-269F19.9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RP11-269F19.9 (also known as TCTEX1D4) belongs to the dynein light chain Tctex-type family. The exact function of RP11-269F19.9 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RP11-269F19.9 antibody (70R-3967) | RP11-269F19.9 antibody (70R-3967) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors