RP11-298P3.3 antibody (70R-4036)

Rabbit polyclonal RP11-298P3.3 antibody raised against the N terminal of RP11-298P3.3

Synonyms Polyclonal RP11-298P3.3 antibody, Anti-RP11-298P3.3 antibody, RP11-298P3.3, CG005 antibody, RP-298P3.3 11, 92M18.3 antibody, RP-298P3.3 11 antibody, FLJ43077 antibody, Nedd4 Binding Protein 2-Like 2 antibody, FLJ41089 antibody, PFAAP5 antibody, RP-298P3.3-11 antibody, FLJ36195 antibody, RP-298P3.3-11
Specificity RP11-298P3.3 antibody was raised against the N terminal of RP11-298P3.3
Cross Reactivity Human
Applications WB
Immunogen RP11-298P3.3 antibody was raised using the N terminal of RP11-298P3.3 corresponding to a region with amino acids EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN
Assay Information RP11-298P3.3 Blocking Peptide, catalog no. 33R-2828, is also available for use as a blocking control in assays to test for specificity of this RP11-298P3.3 antibody

Images

Western Blot analysis using RP11-298P3.3 antibody (70R-4036)

RP11-298P3.3 antibody (70R-4036) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RP11-298P3.3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RP11-298P3.3 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RP11-298P3.3 antibody (70R-4036) | RP11-298P3.3 antibody (70R-4036) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors