RP11-50D16.3 antibody (70R-6825)

Rabbit polyclonal RP11-50D16.3 antibody raised against the middle region of Rp11-50D16.3

Synonyms Polyclonal RP11-50D16.3 antibody, Anti-RP11-50D16.3 antibody, DKFZp313M1221 antibody, RP-50D16.3 11 antibody, RP-50D16.3-11, RP-50D16.3 11, RP-50D16.3-11 antibody, RP11-50D16.3, DKFZp686E1140 antibody, LOC387921 antibody
Specificity RP11-50D16.3 antibody was raised against the middle region of Rp11-50D16.3
Cross Reactivity Human
Applications WB
Immunogen RP11-50D16.3 antibody was raised using the middle region of Rp11-50D16.3 corresponding to a region with amino acids LVQVLGTPGKKGTSLNPLQFDNPAELYVEDTGDIYIVDGDGGLNNRLIKL
Assay Information RP11-50D16.3 Blocking Peptide, catalog no. 33R-5535, is also available for use as a blocking control in assays to test for specificity of this RP11-50D16.3 antibody

Images

Western Blot analysis using RP11-50D16.3 antibody (70R-6825)

RP11-50D16.3 antibody (70R-6825) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RP11-50D16.3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RP11-50D16.3 contains 4 NHL repeats. The function of the RP11-50D16.3 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RP11-50D16.3 antibody (70R-6825) | RP11-50D16.3 antibody (70R-6825) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors