RP11-78J21.1 antibody (70R-4772)

Rabbit polyclonal RP11-78J21.1 antibody raised against the N terminal of RP11-78J21.1

Synonyms Polyclonal RP11-78J21.1 antibody, Anti-RP11-78J21.1 antibody, RP-78J21.1-11, RP-78J21.1 11 antibody, RP-78J21.1 11, RP-78J21.1-11 antibody, Heterogeneous Nuclear Ribonucleoprotein A1-Like antibody, RP11-78J21.1
Specificity RP11-78J21.1 antibody was raised against the N terminal of RP11-78J21.1
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen RP11-78J21.1 antibody was raised using the N terminal of RP11-78J21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
Assay Information RP11-78J21.1 Blocking Peptide, catalog no. 33R-6454, is also available for use as a blocking control in assays to test for specificity of this RP11-78J21.1 antibody


Immunohistochemical staining using RP11-78J21.1 antibody (70R-4772)

RP11-78J21.1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epidermal cells (arrows) in Human Skin. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RP11-78J21.1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RP11-78J21.1 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using RP11-78J21.1 antibody (70R-4772) | RP11-78J21.1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epidermal cells (arrows) in Human Skin. Magnification is at 400X
  • Western Blot analysis using RP11-78J21.1 antibody (70R-4772) | RP11-78J21.1 antibody (70R-4772) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors