RP13-102H20.1 antibody (70R-7518)

Rabbit polyclonal RP13-102H20.1 antibody raised against the N terminal of RP13-102H20.1

Synonyms Polyclonal RP13-102H20.1 antibody, Anti-RP13-102H20.1 antibody, RP-102H20.1-13, RP13-102H20.1, Hypothetical Protein Flj30058 antibody, FLJ30058 antibody, RP-102H20.1 13 antibody, RP-102H20.1 13, RP-102H20.1-13 antibody
Specificity RP13-102H20.1 antibody was raised against the N terminal of RP13-102H20.1
Cross Reactivity Human
Applications WB
Immunogen RP13-102H20.1 antibody was raised using the N terminal of RP13-102H20.1 corresponding to a region with amino acids VARHFLSEFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVL
Assay Information RP13-102H20.1 Blocking Peptide, catalog no. 33R-4580, is also available for use as a blocking control in assays to test for specificity of this RP13-102H20.1 antibody


Western Blot analysis using RP13-102H20.1 antibody (70R-7518)

RP13-102H20.1 antibody (70R-7518) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RP13-102H20.1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RP13-102H20.1 is the GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RP13-102H20.1 antibody (70R-7518) | RP13-102H20.1 antibody (70R-7518) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors