RPA1 antibody (70R-5545)

Rabbit polyclonal RPA1 antibody raised against the middle region of RPA1

Synonyms Polyclonal RPA1 antibody, Anti-RPA1 antibody, RPA-1 antibody, RPA1, RP-A antibody, RPA70 antibody, HSSB antibody, RPA-1, RF-A antibody, RPA 1, Replication Protein A1 70Kda antibody, REPA1 antibody, RPA 1 antibody
Specificity RPA1 antibody was raised against the middle region of RPA1
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen RPA1 antibody was raised using the middle region of RPA1 corresponding to a region with amino acids SRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKI
Assay Information RPA1 Blocking Peptide, catalog no. 33R-8749, is also available for use as a blocking control in assays to test for specificity of this RPA1 antibody


Western Blot analysis using RPA1 antibody (70R-5545)

RPA1 antibody (70R-5545) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPA1 plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPA1 antibody (70R-5545) | RPA1 antibody (70R-5545) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors