RPA1 antibody (70R-5546)

Rabbit polyclonal RPA1 antibody raised against the middle region of RPA1

Synonyms Polyclonal RPA1 antibody, Anti-RPA1 antibody, RPA-1, RPA 1 antibody, HSSB antibody, RPA70 antibody, RP-A antibody, RPA-1 antibody, Replication Protein A1 70Kda antibody, RF-A antibody, RPA1, REPA1 antibody, RPA 1
Specificity RPA1 antibody was raised against the middle region of RPA1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RPA1 antibody was raised using the middle region of RPA1 corresponding to a region with amino acids TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA
Assay Information RPA1 Blocking Peptide, catalog no. 33R-9194, is also available for use as a blocking control in assays to test for specificity of this RPA1 antibody


Western Blot analysis using RPA1 antibody (70R-5546)

RPA1 antibody (70R-5546) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPA1 plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPA1 antibody (70R-5546) | RPA1 antibody (70R-5546) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors