RPA4 antibody (70R-5577)

Rabbit polyclonal RPA4 antibody raised against the middle region of RPA4

Synonyms Polyclonal RPA4 antibody, Anti-RPA4 antibody, Replication Protein A4 34Kda antibody, RPA 4, RPA 4 antibody, RPA4, MGC120334 antibody, RPA-4, RPA-4 antibody, HSU24186 antibody, MGC120333 antibody
Specificity RPA4 antibody was raised against the middle region of RPA4
Cross Reactivity Human
Applications WB
Immunogen RPA4 antibody was raised using the middle region of RPA4 corresponding to a region with amino acids VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD
Assay Information RPA4 Blocking Peptide, catalog no. 33R-9743, is also available for use as a blocking control in assays to test for specificity of this RPA4 antibody

Images

Western Blot analysis using RPA4 antibody (70R-5577)

RPA4 antibody (70R-5577) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. RPA4 is the 32 kDa subunit of the RPA, which associates with the 70- and 13 kDa subunits to form a trimeric RPA complex. Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RPA4 antibody (70R-5577) | RPA4 antibody (70R-5577) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors