RPE antibody (70R-4057)

Rabbit polyclonal RPE antibody raised against the N terminal of RPE

Synonyms Polyclonal RPE antibody, Anti-RPE antibody, Ribulose-5-Phosphate-3-Epimerase antibody, RPE2-1 antibody, MGC2636 antibody
Specificity RPE antibody was raised against the N terminal of RPE
Cross Reactivity Human
Applications WB
Immunogen RPE antibody was raised using the N terminal of RPE corresponding to a region with amino acids ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ
Assay Information RPE Blocking Peptide, catalog no. 33R-1339, is also available for use as a blocking control in assays to test for specificity of this RPE antibody

Images

Western Blot analysis using RPE antibody (70R-4057)

RPE antibody (70R-4057) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPE is the enzyme that converts D-ribulose 5-phosphate into D-xylulose 5-phosphate in Calvin's reductive pentose phosphate cycle.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RPE antibody (70R-4057) | RPE antibody (70R-4057) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors