RPESP antibody (70R-3306)

Rabbit polyclonal RPESP antibody raised against the C terminal of RPESP

Synonyms Polyclonal RPESP antibody, Anti-RPESP antibody, FLJ40021 antibody, Rpe-Spondin antibody
Specificity RPESP antibody was raised against the C terminal of RPESP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RPESP antibody was raised using the C terminal of RPESP corresponding to a region with amino acids WMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC
Assay Information RPESP Blocking Peptide, catalog no. 33R-9981, is also available for use as a blocking control in assays to test for specificity of this RPESP antibody

Images

Western Blot analysis using RPESP antibody (70R-3306)

RPESP antibody (70R-3306) used at 2 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPESP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RPESP antibody (70R-3306) | RPESP antibody (70R-3306) used at 2 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors