RPIA antibody (70R-4423)

Rabbit polyclonal RPIA antibody

Synonyms Polyclonal RPIA antibody, Anti-RPIA antibody, Ribose 5-Phosphate Isomerase A antibody, RPI antibody, Ribose 5-Phosphate Epimerase antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG
Assay Information RPIA Blocking Peptide, catalog no. 33R-6341, is also available for use as a blocking control in assays to test for specificity of this RPIA antibody


Western Blot analysis using RPIA antibody (70R-4423)

RPIA antibody (70R-4423) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPIA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency. The exact function of RPIA remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPIA antibody (70R-4423) | RPIA antibody (70R-4423) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors