RPL10A antibody (70R-3311)

Rabbit polyclonal RPL10A antibody raised against the N terminal of RPL10A

Synonyms Polyclonal RPL10A antibody, Anti-RPL10A antibody, RPL 10, RPL-10 antibody, NEDD6 antibody, RPL10, Csa-19 antibody, RPL 10 antibody, Ribosomal Protein L10A antibody, RPL-10
Specificity RPL10A antibody was raised against the N terminal of RPL10A
Cross Reactivity Human
Applications WB
Immunogen RPL10A antibody was raised using the N terminal of RPL10A corresponding to a region with amino acids MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS
Assay Information RPL10A Blocking Peptide, catalog no. 33R-6498, is also available for use as a blocking control in assays to test for specificity of this RPL10A antibody


Western Blot analysis using RPL10A antibody (70R-3311)

RPL10A antibody (70R-3311) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPL10A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm. The expression of this gene is downregulated in the thymus by cyclosporin-A (CsA), an immunosuppressive drug. Studies in mice have shown that the expression of the ribosomal protein L10a gene is downregulated in neural precursor cells during development.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPL10A antibody (70R-3311) | RPL10A antibody (70R-3311) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors