RPL30 antibody (70R-2180)

Rabbit polyclonal RPL30 antibody raised against the middle region of RPL30

Synonyms Polyclonal RPL30 antibody, Anti-RPL30 antibody, RPL30, RPL 30, RPL-30 antibody, Ribosomal Protein L30 antibody, RPL-30, RPL 30 antibody
Specificity RPL30 antibody was raised against the middle region of RPL30
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RPL30 antibody was raised using the middle region of RPL30 corresponding to a region with amino acids MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE
Assay Information RPL30 Blocking Peptide, catalog no. 33R-6177, is also available for use as a blocking control in assays to test for specificity of this RPL30 antibody

Images

Western Blot analysis using RPL30 antibody (70R-2180)

RPL30 antibody (70R-2180) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPL30 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL30 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene encoding RPL30 is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RPL30 antibody (70R-2180) | RPL30 antibody (70R-2180) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors