RPL32 antibody (70R-1471)

Rabbit polyclonal RPL32 antibody raised against the N terminal of RPL32

Synonyms Polyclonal RPL32 antibody, Anti-RPL32 antibody, RPL-32, RPL 32, RPL32, RPL 32 antibody, Ribosomal Protein L32 antibody, RPL-32 antibody
Specificity RPL32 antibody was raised against the N terminal of RPL32
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen RPL32 antibody was raised using the N terminal of RPL32 corresponding to a region with amino acids AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG
Assay Information RPL32 Blocking Peptide, catalog no. 33R-1035, is also available for use as a blocking control in assays to test for specificity of this RPL32 antibody


Western Blot analysis using RPL32 antibody (70R-1471)

RPL32 antibody (70R-1471) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RPL32 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPL32 is a ribosomal protein that is a component of the 60S subunit. RPL32 belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPL32 antibody (70R-1471) | RPL32 antibody (70R-1471) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors