RPL5 antibody (70R-4629)

Rabbit polyclonal RPL5 antibody raised against the N terminal of RPL5

Synonyms Polyclonal RPL5 antibody, Anti-RPL5 antibody, RPL5, RPL-5, RPL 5 antibody, Ribosomal Protein L5 antibody, MSTP030 antibody, MGC117339 antibody, RPL 5, RPL-5 antibody
Specificity RPL5 antibody was raised against the N terminal of RPL5
Cross Reactivity Human,Mouse,Rat,Arabidopsis,Drosophila
Applications WB
Immunogen RPL5 antibody was raised using the N terminal of RPL5 corresponding to a region with amino acids RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP
Assay Information RPL5 Blocking Peptide, catalog no. 33R-8055, is also available for use as a blocking control in assays to test for specificity of this RPL5 antibody


Western blot analysis using RPL5 antibody (70R-4629)

Recommended RPL5 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPL5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPL5 is required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using RPL5 antibody (70R-4629) | Recommended RPL5 Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using RPL5 antibody (70R-4629) | Sample Type: Arabidopsis thaliana extract (30ug) Primary Diltution: 1:1000 Secondary Antibody: anti-rabbit HRP Secondary Dilution: 1:15,000 Exposure Time: 1 minute

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors