RPL9 antibody (70R-1401)

Rabbit polyclonal RPL9 antibody raised against the C terminal of RPL9

Synonyms Polyclonal RPL9 antibody, Anti-RPL9 antibody, RPL 9, RPL-9, RPL 9 antibody, Ribosomal Protein L9 antibody, RPL-9 antibody, RPL9
Specificity RPL9 antibody was raised against the C terminal of RPL9
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE
Assay Information RPL9 Blocking Peptide, catalog no. 33R-2552, is also available for use as a blocking control in assays to test for specificity of this RPL9 antibody


Western Blot analysis using RPL9 antibody (70R-1401)

RPL9 antibody (70R-1401) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RPL9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPL9 is a ribosomal protein that is a component of the 60S subunit. RPL9 belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPL9 antibody (70R-1401) | RPL9 antibody (70R-1401) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors