RPLP0 antibody (70R-1442)

Rabbit polyclonal RPLP0 antibody raised against the middle region of RPLP0

Synonyms Polyclonal RPLP0 antibody, Anti-RPLP0 antibody, RPP0 antibody, PRLP0 antibody, Ribosomal Protein Large P0 antibody, L10E antibody, MGC88175 antibody, P0 antibody
Specificity RPLP0 antibody was raised against the middle region of RPLP0
Cross Reactivity Human, Dog
Applications WB
Immunogen RPLP0 antibody was raised using the middle region of RPLP0 corresponding to a region with amino acids PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY
Assay Information RPLP0 Blocking Peptide, catalog no. 33R-7085, is also available for use as a blocking control in assays to test for specificity of this RPLP0 antibody

Images

Western Blot analysis using RPLP0 antibody (70R-1442)

RPLP0 antibody (70R-1442) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RPLP0 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RPLP0 antibody (70R-1442) | RPLP0 antibody (70R-1442) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors