RPLP0 antibody (70R-4936)

Rabbit polyclonal RPLP0 antibody raised against the N terminal of RPLP0

Synonyms Polyclonal RPLP0 antibody, Anti-RPLP0 antibody, PRLP0 antibody, MGC88175 antibody, P0 antibody, Ribosomal Protein Large P0 antibody, RPP0 antibody, L10E antibody, MGC111226 antibody
Specificity RPLP0 antibody was raised against the N terminal of RPLP0
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RPLP0 antibody was raised using the N terminal of RPLP0 corresponding to a region with amino acids TEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITT
Assay Information RPLP0 Blocking Peptide, catalog no. 33R-9044, is also available for use as a blocking control in assays to test for specificity of this RPLP0 antibody

Images

Western Blot analysis using RPLP0 antibody (70R-4936)

RPLP0 antibody (70R-4936) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPLP0 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RPLP0 antibody (70R-4936) | RPLP0 antibody (70R-4936) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors