RPRD1B antibody (70R-3872)

Rabbit polyclonal RPRD1B antibody raised against the middle region of RPRD1B

Synonyms Polyclonal RPRD1B antibody, Anti-RPRD1B antibody, RPRDB-1 antibody, dJ1057B20.2 antibody, CREPT antibody, RPRDB 1, RPRDB 1 antibody, FLJ44520 antibody, DKFZp434P0735 antibody, RPRDB-1, Regulation Of Nuclear Pre-mRNA Domain Containing 1B antibody, RPRD1B
Specificity RPRD1B antibody was raised against the middle region of RPRD1B
Cross Reactivity Human
Applications WB
Immunogen RPRD1B antibody was raised using the middle region of RPRD1B corresponding to a region with amino acids KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAAS
Assay Information RPRD1B Blocking Peptide, catalog no. 33R-4494, is also available for use as a blocking control in assays to test for specificity of this RPRD1B antibody


Western Blot analysis using RPRD1B antibody (70R-3872)

RPRD1B antibody (70R-3872) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPRD1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RPRD1B protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPRD1B antibody (70R-3872) | RPRD1B antibody (70R-3872) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors