RPS6KB1 antibody (70R-3693)

Rabbit polyclonal RPS6KB1 antibody raised against the N terminal of RPS6KB1

Synonyms Polyclonal RPS6KB1 antibody, Anti-RPS6KB1 antibody, p70-alpha antibody, RPSKB1 6, p70(S6K)-alpha antibody, RPSKB1-6 antibody, RPSKB1 6 antibody, STK14A antibody, PS6K antibody, S6K1 antibody, RPS6KB1, S6K antibody, p70-S6K antibody, Ribosomal Protein S6 Kinase 70Kda Polypeptide 1 antibody, RPSKB1-6
Specificity RPS6KB1 antibody was raised against the N terminal of RPS6KB1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RPS6KB1 antibody was raised using the N terminal of RPS6KB1 corresponding to a region with amino acids KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
Assay Information RPS6KB1 Blocking Peptide, catalog no. 33R-4368, is also available for use as a blocking control in assays to test for specificity of this RPS6KB1 antibody


Western Blot analysis using RPS6KB1 antibody (70R-3693)

RPS6KB1 antibody (70R-3693) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPS6KB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPS6KB1 antibody (70R-3693) | RPS6KB1 antibody (70R-3693) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors