RPS7 antibody (70R-4830)

Rabbit polyclonal RPS7 antibody raised against the N terminal of RPS7

Synonyms Polyclonal RPS7 antibody, Anti-RPS7 antibody, RPS-7, RPS-7 antibody, RPS7, Ribosomal Protein S7 antibody, RPS 7, RPS 7 antibody
Specificity RPS7 antibody was raised against the N terminal of RPS7
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RPS7 antibody was raised using the N terminal of RPS7 corresponding to a region with amino acids MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE
Assay Information RPS7 Blocking Peptide, catalog no. 33R-6006, is also available for use as a blocking control in assays to test for specificity of this RPS7 antibody


Western Blot analysis using RPS7 antibody (70R-4830)

RPS7 antibody (70R-4830) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPS7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPS7 is required for rRNA maturation.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPS7 antibody (70R-4830) | RPS7 antibody (70R-4830) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors