RPSA antibody (70R-6040)

Rabbit polyclonal RPSA antibody raised against the middle region of RPSA

Synonyms Polyclonal RPSA antibody, Anti-RPSA antibody, LAMR1 antibody, LAMBR antibody, LRP antibody, Ribosomal Protein Sa antibody, 67LR antibody, p40 antibody, 37LRP antibody
Specificity RPSA antibody was raised against the middle region of RPSA
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RPSA antibody was raised using the middle region of RPSA corresponding to a region with amino acids TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY
Assay Information RPSA Blocking Peptide, catalog no. 33R-9077, is also available for use as a blocking control in assays to test for specificity of this RPSA antibody

Images

Western Blot analysis using RPSA antibody (70R-6040)

RPSA antibody (70R-6040) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPSA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPSA is required for the assembly and/or stability of the 40S ribosomal subunit. RPSA is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. RPSA plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. RPSA may play a role in cell fate determination and tissue morphogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RPSA antibody (70R-6040) | RPSA antibody (70R-6040) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors