RRAGD antibody (70R-3629)

Rabbit polyclonal RRAGD antibody raised against the middle region of RRAGD

Synonyms Polyclonal RRAGD antibody, Anti-RRAGD antibody, RAGD antibody, bA11D8.2.1 antibody, Ras-Related Gtp Binding D antibody, DKFZP761H171 antibody
Specificity RRAGD antibody was raised against the middle region of RRAGD
Cross Reactivity Human
Applications WB
Immunogen RRAGD antibody was raised using the middle region of RRAGD corresponding to a region with amino acids CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL
Assay Information RRAGD Blocking Peptide, catalog no. 33R-1669, is also available for use as a blocking control in assays to test for specificity of this RRAGD antibody


Western Blot analysis using RRAGD antibody (70R-3629)

RRAGD antibody (70R-3629) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RRAGD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RRAGD is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RRAGD antibody (70R-3629) | RRAGD antibody (70R-3629) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors