RRM1 antibody (70R-1618)

Rabbit polyclonal RRM1 antibody raised against the N terminal of RRM1

Synonyms Polyclonal RRM1 antibody, Anti-RRM1 antibody, RRM-1, Ribonucleotide Reductase M1 Polypeptide antibody, RIR1 antibody, R1 antibody, RRM-1 antibody, RRM 1 antibody, RRM 1, RRM1, RR1 antibody
Specificity RRM1 antibody was raised against the N terminal of RRM1
Cross Reactivity Human,Mouse,Rat,Dog,C.elegans,ZebraFish
Applications WB
Immunogen RRM1 antibody was raised using the N terminal of RRM1 corresponding to a region with amino acids ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL
Assay Information RRM1 Blocking Peptide, catalog no. 33R-1558, is also available for use as a blocking control in assays to test for specificity of this RRM1 antibody

Images

Western Blot analysis using RRM1 antibody (70R-1618)

RRM1 antibody (70R-1618) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RRM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RRM1 is one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. Its gene is located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. Its gene may play a role in malignancies and disease that involve this region.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RRM1 antibody (70R-1618) | RRM1 antibody (70R-1618) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors