RRM2 antibody (70R-5609)

Rabbit polyclonal RRM2 antibody raised against the N terminal of RRM2

Synonyms Polyclonal RRM2 antibody, Anti-RRM2 antibody, RRM 2, RRM2, RRM 2 antibody, R2 antibody, RRM-2, Ribonucleotide Reductase M2 Polypeptide antibody, RR2M antibody, RRM-2 antibody
Specificity RRM2 antibody was raised against the N terminal of RRM2
Cross Reactivity Human
Applications WB
Immunogen RRM2 antibody was raised using the N terminal of RRM2 corresponding to a region with amino acids PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP
Assay Information RRM2 Blocking Peptide, catalog no. 33R-6966, is also available for use as a blocking control in assays to test for specificity of this RRM2 antibody


Western Blot analysis using RRM2 antibody (70R-5609)

RRM2 antibody (70R-5609) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RRM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RRM2 provides the precursors necessary for DNA synthesis. RRM2 catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. RRM2 inhibits Wnt signaling.Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RRM2 antibody (70R-5609) | RRM2 antibody (70R-5609) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors