RSBN1 antibody (70R-3989)

Rabbit polyclonal RSBN1 antibody raised against the N terminal of RSBN1

Synonyms Polyclonal RSBN1 antibody, Anti-RSBN1 antibody, RSBN-1 antibody, ROSBIN antibody, DKFZp781E21150 antibody, RP11-324J2.1 antibody, Round Spermatid Basic Protein 1 antibody, RSBN-1, RSBN 1 antibody, RSBN1, RSBN 1
Specificity RSBN1 antibody was raised against the N terminal of RSBN1
Cross Reactivity Human
Applications WB
Immunogen RSBN1 antibody was raised using the N terminal of RSBN1 corresponding to a region with amino acids GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG
Assay Information RSBN1 Blocking Peptide, catalog no. 33R-3273, is also available for use as a blocking control in assays to test for specificity of this RSBN1 antibody


Western Blot analysis using RSBN1 antibody (70R-3989)

RSBN1 antibody (70R-3989) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RSBN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RSBN1 may be involved in protein binding.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RSBN1 antibody (70R-3989) | RSBN1 antibody (70R-3989) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors