RSF1 antibody (70R-2111)

Rabbit polyclonal RSF1 antibody raised against the middle region of RSF1

Synonyms Polyclonal RSF1 antibody, Anti-RSF1 antibody, RSF 1, RSF-1 antibody, RSF 1 antibody, RSF1, p325 antibody, HBXAP antibody, RSF-1, Remodeling And Spacing Factor 1 antibody, XAP8 antibody, RSF-1 antibody
Specificity RSF1 antibody was raised against the middle region of RSF1
Cross Reactivity Human
Applications WB
Immunogen RSF1 antibody was raised using the middle region of RSF1 corresponding to a region with amino acids QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK
Assay Information RSF1 Blocking Peptide, catalog no. 33R-7494, is also available for use as a blocking control in assays to test for specificity of this RSF1 antibody


Western Blot analysis using RSF1 antibody (70R-2111)

RSF1 antibody (70R-2111) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 164 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RSF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RSF1 (HBXAP) is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.HBXAP is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RSF1 antibody (70R-2111) | RSF1 antibody (70R-2111) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors