RSPH10B antibody (70R-3407)

Rabbit polyclonal RSPH10B antibody

Synonyms Polyclonal RSPH10B antibody, Anti-RSPH10B antibody, RSPHB 10, RSPHB-10, RSPHB-10 antibody, Radial Spoke Head 10 Homolog B antibody, RSPH10B, MGC50833 antibody, RSPHB 10 antibody
Cross Reactivity Human
Applications WB
Immunogen RSPH10B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN
Assay Information RSPH10B Blocking Peptide, catalog no. 33R-2414, is also available for use as a blocking control in assays to test for specificity of this RSPH10B antibody


Western Blot analysis using RSPH10B antibody (70R-3407)

RSPH10B antibody (70R-3407) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 96 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RSPH10B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RSPH10B protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RSPH10B antibody (70R-3407) | RSPH10B antibody (70R-3407) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors