RTDR1 antibody (70R-3551)

Rabbit polyclonal RTDR1 antibody raised against the middle region of RTDR1

Synonyms Polyclonal RTDR1 antibody, Anti-RTDR1 antibody, RTDR-1, RTDR 1 antibody, MGC16968 antibody, Rhabdoid Tumor Deletion Region Gene 1 antibody, RTDR1, RTDR 1, RTDR-1 antibody
Specificity RTDR1 antibody was raised against the middle region of RTDR1
Cross Reactivity Human
Applications WB
Immunogen RTDR1 antibody was raised using the middle region of RTDR1 corresponding to a region with amino acids IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRA
Assay Information RTDR1 Blocking Peptide, catalog no. 33R-3896, is also available for use as a blocking control in assays to test for specificity of this RTDR1 antibody


Western Blot analysis using RTDR1 antibody (70R-3551)

RTDR1 antibody (70R-3551) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RTDR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RTDR1 antibody (70R-3551) | RTDR1 antibody (70R-3551) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors