RTN1 antibody (70R-6578)

Rabbit polyclonal RTN1 antibody raised against the middle region of RTN1

Synonyms Polyclonal RTN1 antibody, Anti-RTN1 antibody, RTN1, RTN 1, Reticulon 1 antibody, RTN-1, RTN-1 antibody, RTN 1 antibody, NSP antibody, MGC133250 antibody
Specificity RTN1 antibody was raised against the middle region of RTN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RTN1 antibody was raised using the middle region of RTN1 corresponding to a region with amino acids MAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE
Assay Information RTN1 Blocking Peptide, catalog no. 33R-5805, is also available for use as a blocking control in assays to test for specificity of this RTN1 antibody


Western Blot analysis using RTN1 antibody (70R-6578)

RTN1 antibody (70R-6578) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RTN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RTN1 antibody (70R-6578) | RTN1 antibody (70R-6578) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors