RTN1 antibody (70R-6965)

Rabbit polyclonal RTN1 antibody raised against the N terminal of RTN1

Synonyms Polyclonal RTN1 antibody, Anti-RTN1 antibody, RTN 1 antibody, RTN-1 antibody, NSP antibody, RTN-1, MGC133250 antibody, Reticulon 1 antibody, RTN1, RTN 1
Specificity RTN1 antibody was raised against the N terminal of RTN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RTN1 antibody was raised using the N terminal of RTN1 corresponding to a region with amino acids EEREAELDSELIIESCDASSASEESPKREQDSPPMKPSALDAIREETGVR
Assay Information RTN1 Blocking Peptide, catalog no. 33R-2384, is also available for use as a blocking control in assays to test for specificity of this RTN1 antibody

Images

Western Blot analysis using RTN1 antibody (70R-6965)

RTN1 antibody (70R-6965) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RTN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RTN1 antibody (70R-6965) | RTN1 antibody (70R-6965) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors