RTN4 antibody (70R-7139)

Rabbit polyclonal RTN4 antibody raised against the middle region of RTN4

Synonyms Polyclonal RTN4 antibody, Anti-RTN4 antibody, RTN 4, NOGOC antibody, RTN4-C antibody, RTN-4 antibody, RTN-X antibody, Nbla00271 antibody, Reticulon 4 antibody, Nbla10545 antibody, Nogo-C antibody, ASY antibody, NI220/250 antibody, RTN4-B2 antibody, RTN4-A antibody, NSP-CL antibody, RTN4, RTN4-B1 antibody, NOGO-A antibody, RTN 4 antibody, Nogo-B antibody, RTN-4, NOGO antibody, NSP antibody
Specificity RTN4 antibody was raised against the middle region of RTN4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI
Assay Information RTN4 Blocking Peptide, catalog no. 33R-3051, is also available for use as a blocking control in assays to test for specificity of this RTN4 antibody

Images

Western Blot analysis using RTN4 antibody (70R-7139)

RTN4 antibody (70R-7139) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RTN4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RTN4 belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. RTN4 is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RTN4 antibody (70R-7139) | RTN4 antibody (70R-7139) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors