RUNX2 antibody (70R-1010)

Rabbit polyclonal RUNX2 antibody raised against the middle region of RUNX2

Synonyms Polyclonal RUNX2 antibody, Anti-RUNX2 antibody, RUNX2, RUNX-2, Runt-Related Transcription Factor 2 antibody, RUNX 2, RUNX-2 antibody, RUNX 2 antibody
Specificity RUNX2 antibody was raised against the middle region of RUNX2
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM
Assay Information RUNX2 Blocking Peptide, catalog no. 33R-2188, is also available for use as a blocking control in assays to test for specificity of this RUNX2 antibody

Images

Western blot analysis using RUNX2 antibody (70R-1010)

Recommended RUNX2 Antibody Titration: 1.25ug/ml

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RUNX2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RUNX2 is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis, acting as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants, encoding different protein isoforms, result from alternate promoter use as well as alternate splicing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using RUNX2 antibody (70R-1010) | Recommended RUNX2 Antibody Titration: 1.25ug/ml

Availability: In stock

Price: $315.00
Size: 100 ug
OR
Shipping
View Our Distributors