RWDD4A antibody (70R-3398)

Rabbit polyclonal RWDD4A antibody raised against the middle region of RWDD4A

Synonyms Polyclonal RWDD4A antibody, Anti-RWDD4A antibody, RWDD 4 antibody, MGC10198 antibody, RWDD-4 antibody, Rwd Domain Containing 4A antibody, RWDD-4, RWDD 4, RWDD4, FAM28A antibody
Specificity RWDD4A antibody was raised against the middle region of RWDD4A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RWDD4A antibody was raised using the middle region of RWDD4A corresponding to a region with amino acids SSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLSKTGSKDD
Assay Information RWDD4A Blocking Peptide, catalog no. 33R-8816, is also available for use as a blocking control in assays to test for specificity of this RWDD4A antibody

Images

Western Blot analysis using RWDD4A antibody (70R-3398)

RWDD4A antibody (70R-3398) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RWDD4A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RWDD4 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RWDD4A antibody (70R-3398) | RWDD4A antibody (70R-3398) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors