RWDD4A antibody (70R-4176)

Rabbit polyclonal RWDD4A antibody raised against the N terminal of RWDD4A

Synonyms Polyclonal RWDD4A antibody, Anti-RWDD4A antibody, Rwd Domain Containing 4A antibody, RWDD 4 antibody, FAM28A antibody, RWDD-4 antibody, RWDD-4, MGC10198 antibody, RWDD4, RWDD 4
Specificity RWDD4A antibody was raised against the N terminal of RWDD4A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RWDD4A antibody was raised using the N terminal of RWDD4A corresponding to a region with amino acids MSANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEIS
Assay Information RWDD4A Blocking Peptide, catalog no. 33R-6396, is also available for use as a blocking control in assays to test for specificity of this RWDD4A antibody


Western Blot analysis using RWDD4A antibody (70R-4176)

RWDD4A antibody (70R-4176) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RWDD4A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RWDD4 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RWDD4A antibody (70R-4176) | RWDD4A antibody (70R-4176) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors