RXRG antibody (70R-1925)

Rabbit polyclonal RXRG antibody raised against the N terminal of RXRG

Synonyms Polyclonal RXRG antibody, Anti-RXRG antibody, NR2B3 antibody, Retinoid X Receptor Gamma antibody, RXRC antibody
Specificity RXRG antibody was raised against the N terminal of RXRG
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RXRG antibody was raised using the N terminal of RXRG corresponding to a region with amino acids NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH
Assay Information RXRG Blocking Peptide, catalog no. 33R-6930, is also available for use as a blocking control in assays to test for specificity of this RXRG antibody

Images

Western blot analysis using RXRG antibody (70R-1925)

Recommended RXRG Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RXRG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RXRG encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. RXRG is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using RXRG antibody (70R-1925) | Recommended RXRG Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors