S100A8 Blocking Peptide (33R-10388)

A synthetic peptide for use as a blocking control in assays to test for specificity of S100A8 antibody, catalog no. 70R-10302

Synonyms S100A8 control peptide, S100A8 antibody Blocking Peptide, Anti-S100A8 Blocking Peptide, S100 calcium binding protein A8 Blocking Peptide, 60B8AG Blocking Peptide, CAGA Blocking Peptide, CFAG Blocking Peptide, CGLA Blocking Peptide, CP-10 Blocking Peptide, L1Ag Blocking Peptide, MA387 Blocking Peptide, MIF Blocking Peptide, MRP8 Blocking Peptide, NIF Blocking Peptide, P8 Blocking Peptide, S100A8, SA8-100, SA8 100, SA8-100 Blocking Peptide, SA8 100 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Molecular Weight 10 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors