S100A9 antibody (70R-5716)

Rabbit polyclonal S100A9 antibody raised against the N terminal of S100A9

Synonyms Polyclonal S100A9 antibody, Anti-S100A9 antibody, CFAG antibody, S-100, P14 antibody, S100, MAC387 antibody, MRP14 antibody, S 100, LIAG antibody, 60B8AG antibody, S 100 antibody, CAGB antibody, S-100 antibody, NIF antibody, S100 Calcium Binding Protein A9 antibody, CGLB antibody, MIF antibody, L1AG antibody
Specificity S100A9 antibody was raised against the N terminal of S100A9
Cross Reactivity Human
Applications WB
Immunogen S100A9 antibody was raised using the N terminal of S100A9 corresponding to a region with amino acids MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK
Assay Information S100A9 Blocking Peptide, catalog no. 33R-6535, is also available for use as a blocking control in assays to test for specificity of this S100A9 antibody


Western Blot analysis using S100A9 antibody (70R-5716)

S100A9 antibody (70R-5716) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of S100A9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using S100A9 antibody (70R-5716) | S100A9 antibody (70R-5716) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors