S100PBP antibody (70R-4447)

Rabbit polyclonal S100PBP antibody raised against the middle region of S100PBP

Synonyms Polyclonal S100PBP antibody, Anti-S100PBP antibody, S100PBP, DKFZp313K2325 antibody, SPBP 100 antibody, SPBP-100, SPBP-100 antibody, S100P Binding Protein antibody, FLJ12903 antibody, S100PBPR antibody, SPBP 100
Specificity S100PBP antibody was raised against the middle region of S100PBP
Cross Reactivity Human
Applications WB
Immunogen S100PBP antibody was raised using the middle region of S100PBP corresponding to a region with amino acids ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ
Assay Information S100PBP Blocking Peptide, catalog no. 33R-2713, is also available for use as a blocking control in assays to test for specificity of this S100PBP antibody


Western Blot analysis using S100PBP antibody (70R-4447)

S100PBP antibody (70R-4447) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of S100PBP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of S100PBP protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using S100PBP antibody (70R-4447) | S100PBP antibody (70R-4447) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors