SAA4 antibody (70R-5924)

Rabbit polyclonal SAA4 antibody raised against the middle region of SAA4

Synonyms Polyclonal SAA4 antibody, Anti-SAA4 antibody, C-SAA antibody, CSAA antibody, Serum Amyloid A4 Constitutive antibody
Specificity SAA4 antibody was raised against the middle region of SAA4
Cross Reactivity Human
Applications WB
Immunogen SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF
Assay Information SAA4 Blocking Peptide, catalog no. 33R-1030, is also available for use as a blocking control in assays to test for specificity of this SAA4 antibody


Western Blot analysis using SAA4 antibody (70R-5924)

SAA4 antibody (70R-5924) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 2 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SAA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SAA4 is a major acute phase reactant. It is an Apolipoprotein of the HDL complex.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SAA4 antibody (70R-5924) | SAA4 antibody (70R-5924) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors