SAAL1 antibody (70R-4566)

Rabbit polyclonal SAAL1 antibody raised against the middle region of SAAL1

Synonyms Polyclonal SAAL1 antibody, Anti-SAAL1 antibody, Serum Amyloid A-Like 1 antibody, FLJ41463 antibody
Specificity SAAL1 antibody was raised against the middle region of SAAL1
Cross Reactivity Human
Applications WB
Immunogen SAAL1 antibody was raised using the middle region of SAAL1 corresponding to a region with amino acids EKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWL
Assay Information SAAL1 Blocking Peptide, catalog no. 33R-2513, is also available for use as a blocking control in assays to test for specificity of this SAAL1 antibody


Western Blot analysis using SAAL1 antibody (70R-4566)

SAAL1 antibody (70R-4566) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SAAL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of SAA protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SAAL1 antibody (70R-4566) | SAAL1 antibody (70R-4566) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors